Sequence 1: | NP_724708.1 | Gene: | gcl / 35864 | FlyBaseID: | FBgn0005695 | Length: | 569 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001316524.1 | Gene: | KLHL10 / 317719 | HGNCID: | 18829 | Length: | 608 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 47/235 - (20%) |
---|---|---|---|
Similarity: | 93/235 - (39%) | Gaps: | 16/235 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 QP-KKKKLLTTTQYIYKALFKEEKNSDVAVMALDKVWHLHK-VYLSQSPYFYTMFNGTWREAQQN 104
Fly 105 FIQITILDDRITVASLDAVFGSMYSDEIEIESADVISVLATATLFHLDGIIDKCAEVMVDNISPE 169
Fly 170 TAIQYYEAACQYGVVGVKKSTFQWFQINLLSIYSKQPNLLRHISIELMSALTASPDLYVMQTEFS 234
Fly 235 LYTLLRTWMFLRLHPDYDPEDPVQRAEAL--KTQELLVNA 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gcl | NP_724708.1 | BTB | 56..163 | CDD:279045 | 26/107 (24%) |
BTB | 67..166 | CDD:197585 | 23/99 (23%) | ||
KLHL10 | NP_001316524.1 | BTB | 29..133 | CDD:279045 | 26/107 (24%) |
PHA03098 | 36..572 | CDD:222983 | 41/213 (19%) | ||
BACK | 141..242 | CDD:197943 | 17/104 (16%) | ||
Kelch 1 | 292..339 | ||||
Kelch | 293..339 | CDD:128874 | |||
KELCH repeat | 329..372 | CDD:276965 | |||
Kelch 2 | 340..386 | ||||
Kelch | 341..386 | CDD:128874 | |||
Kelch_1 | 375..419 | CDD:279660 | |||
KELCH repeat | 376..420 | CDD:276965 | |||
Kelch 3 | 388..433 | ||||
KELCH repeat | 423..466 | CDD:276965 | |||
Kelch | 434..480 | CDD:128874 | |||
Kelch 4 | 434..480 | ||||
KELCH repeat | 470..513 | CDD:276965 | |||
Kelch | 481..527 | CDD:128874 | |||
Kelch 5 | 481..527 | ||||
KELCH repeat | 517..561 | CDD:276965 | |||
Kelch | 528..574 | CDD:128874 | |||
Kelch 6 | 529..574 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |