DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gcl and btb2

DIOPT Version :9

Sequence 1:NP_724708.1 Gene:gcl / 35864 FlyBaseID:FBgn0005695 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_596074.1 Gene:btb2 / 2540546 PomBaseID:SPBC25B2.06c Length:284 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:48/224 - (21%)
Similarity:93/224 - (41%) Gaps:45/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KKLLTTTQYIYKALFKEEKNSDVAVMALDKVWHLHKVYLSQSPYF--------------YTMFNG 96
            |.:.:.:.:::.|.|.:...||..::...:.:|||.::|.:||..              ||    
pombe    17 KPVSSISSFVFNAGFLQGTFSDTTLIIKGETYHLHALFLGRSPVLLQKLIENNPKGDVHYT---- 77

  Fly    97 TWREAQQNFIQITILDDRITVASLDAVFGSMYSDEIEIES-ADVISVLATATLFHLDGIIDKCAE 160
                     |::...|..:|..|...|..::|.|...|.: .:|.||||.:.|..||.:..:.:.
pombe    78 ---------IEVETEDPYVTKESCLFVLSTLYCDSPRIPAEVNVCSVLAVSDLLGLDTLAFEASS 133

  Fly   161 VMVDNISPET---AIQYYEAACQYGVVGVKKSTFQWFQINLLS-----IY--------SKQPNLL 209
            ::..:|.|||   .|::.:...: |:..:|...:..|...|.:     :|        ::...||
pombe   134 LIEKSIRPETMESVIRFLDPNFE-GLERLKMGMYPRFTSGLFNKAIQVMYNTLVSNWNTEYARLL 197

  Fly   210 RHISIELMSALTASPDLYVMQTEFSLYTL 238
            .::..|::..|..|..|.|..:..:.|.|
pombe   198 CNLPFEVIKDLLESDKLTVGASSMARYKL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gclNP_724708.1 BTB 56..163 CDD:279045 28/121 (23%)
BTB 67..166 CDD:197585 25/113 (22%)
btb2NP_596074.1 BTB 27..127 CDD:295341 28/112 (25%)
BTB 38..139 CDD:197585 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000347
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.