DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and Pglyrp1

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_445825.1 Gene:Pglyrp1 / 84387 RGDID:621429 Length:183 Species:Rattus norvegicus


Alignment Length:173 Identity:71/173 - (41%)
Similarity:101/173 - (58%) Gaps:6/173 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AVLGVT-----IISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQNIQAYHMD 76
            |:||:.     ::.:|||....:.....|...:.|.||.||||::||:..:|..|.:|:|.|.|.
  Rat    10 ALLGLADSCCFVVPRSEWKALPSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMK 74

  Fly    77 SLGWADIGYNFLIGGDGNVYEGRGWNVMGAH-ATNWNSKSIGISFLGNYNTNTLTSAQITAAKGL 140
            .|||.|:.||||||.||:|||||||.:.|.| ...||..||||:|:|:|:........:.||..|
  Rat    75 QLGWCDVAYNFLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHRVPAKRALRAALNL 139

  Fly   141 LSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWK 183
            |...||.|.:.|.|.:.|||.|.||..||..::..|::|.:::
  Rat   140 LKCGVSEGFLRSNYEVKGHRDVQSTLSPGDQLYEIIQSWDHYR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 61/146 (42%)
Pglyrp1NP_445825.1 PGRP 21..161 CDD:128941 61/139 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345829
Domainoid 1 1.000 128 1.000 Domainoid score I5179
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4342
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - mtm9085
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.670

Return to query results.
Submit another query.