DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and pglyrp1-like.1

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001025626.1 Gene:pglyrp1-like.1 / 595014 XenbaseID:XB-GENE-5778936 Length:182 Species:Xenopus tropicalis


Alignment Length:179 Identity:89/179 - (49%)
Similarity:115/179 - (64%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLAVLFCAQAVLGVTIISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQNI 70
            :.:....|||.|.....|||:|.|||..:..:..|...:.|.:||||||..|::::||..|.:||
 Frog     4 VFIFLTAFCALAQGCPKIISRSSWGGVPSKCQAKLPRSVKYVIIHHTAGASCNSESACKAQARNI 68

  Fly    71 QAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQIT 135
            |.:||.|.||.|.|||||||.||.|||||||..:||||.|:|..||||||:|.:......:|...
 Frog    69 QNFHMKSNGWCDTGYNFLIGEDGQVYEGRGWETVGAHAKNYNFNSIGISFMGTFTNRAPNTAAQK 133

  Fly   136 AAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWKA 184
            |||.|:|..|::..|.|.|.|.|||.|.:|||||||::|.|:.|.|:||
 Frog   134 AAKDLISCGVAKKVINSDYTLKGHRDVSATECPGTNLYNLIKNWPNFKA 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 71/140 (51%)
pglyrp1-like.1NP_001025626.1 PGRP 19..160 CDD:128941 71/140 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4426
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130057
Inparanoid 1 1.050 185 1.000 Inparanoid score I3811
OMA 1 1.010 - - QHG46811
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm48432
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4719
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.