DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and pglyrp6

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001038687.2 Gene:pglyrp6 / 571817 ZFINID:ZDB-GENE-071227-2 Length:498 Species:Danio rerio


Alignment Length:170 Identity:71/170 - (41%)
Similarity:103/170 - (60%) Gaps:12/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IISKSEWGGRSATSKTSLANYLS----YAVIHHT--AGNYCSTKAACITQLQNIQAYHMDSLGWA 81
            ||::|:||   |.|.....:|||    |..||||  ....|:|...|..:::::|.||..|.||:
Zfish   330 IITRSQWG---AASYIGSPSYLSLPVRYLFIHHTYQPSKPCTTFEQCAAEMRSMQRYHQQSNGWS 391

  Fly    82 DIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTL--TSAQITAAKGLLSDA 144
            ||||:|:.|.|||:|||||||.:|||...:||...|:.|:|:| |:||  :||...........|
Zfish   392 DIGYSFVAGSDGNLYEGRGWNWVGAHTYGYNSIGYGVCFIGDY-TSTLPASSAMNMVRYDFTYCA 455

  Fly   145 VSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWKA 184
            .:.|::...|.||||||..:|||||..::.:|:||..:::
Zfish   456 TNGGRLSKSYSLYGHRQAAATECPGNTLYRQIQTWERYQS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 62/146 (42%)
pglyrp6NP_001038687.2 PGRP 328..472 CDD:128941 61/145 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586838
Domainoid 1 1.000 129 1.000 Domainoid score I5198
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4719
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.