DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and pglyrp2

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001038631.1 Gene:pglyrp2 / 568634 ZFINID:ZDB-GENE-071227-1 Length:458 Species:Danio rerio


Alignment Length:167 Identity:56/167 - (33%)
Similarity:90/167 - (53%) Gaps:5/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TIISKSEWGGRSATSKTSLAN-YLSYAVIHHTA--GNYCSTKAACITQLQNIQAYHMDSLGWADI 83
            :||.:..||.........|.: .:|:..|||||  ...|.....|...::.:|.:|....||.||
Zfish   286 SIIPRCIWGAAPPQVPLELLSPPMSFLYIHHTAIPSKPCLNLQTCSQNMRAMQRFHQKDWGWYDI 350

  Fly    84 GYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAK-GLLSDAVSR 147
            ||:|::|.||.:||||||...|||....|:...|::|:|:|:....::..:...: .|:...|:.
Zfish   351 GYSFVVGSDGYIYEGRGWMSQGAHTKGRNNVGYGVAFIGDYSGRLPSTHDMELVRHHLVKCGVNN 415

  Fly   148 GQIVSGYILYGHRQ-VGSTECPGTNIWNEIRTWSNWK 183
            |.:...:.:.|||| |.:|.|||..:::||.||.::|
Zfish   416 GFLQEDFTILGHRQVVVTTSCPGNALYSEITTWMHYK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 46/144 (32%)
pglyrp2NP_001038631.1 PGRP 285..430 CDD:128941 45/143 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586828
Domainoid 1 1.000 129 1.000 Domainoid score I5198
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.