DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and pglyrp1

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_012823786.1 Gene:pglyrp1 / 548492 XenbaseID:XB-GENE-491319 Length:214 Species:Xenopus tropicalis


Alignment Length:182 Identity:98/182 - (53%)
Similarity:132/182 - (72%) Gaps:4/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLAVL--FCAQAVLGVTIISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQ 68
            |.|||:.  .||.|....||::|::||||:||.:|::...:.|.:||||||.:||::.:||:|.:
 Frog    34 LRLLAIFATLCAVANSCPTILTKAQWGGRAATCRTAMTTPVPYVIIHHTAGAHCSSQTSCISQAK 98

  Fly    69 NIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNY-NTNTLTSA 132
            :||.|||:|..|.|:||:||:|.|||||||||||.:||||.|:||.|||||.:|.| |.|..|:|
 Frog    99 SIQNYHMNSNAWCDVGYSFLVGEDGNVYEGRGWNSVGAHAPNYNSNSIGISVMGTYTNINPNTAA 163

  Fly   133 QITAAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWKA 184
            | .|.|.|:|..|::|.|.|.|||.|||.||||||||...:|.::||..::|
 Frog   164 Q-NAVKNLISCGVTKGYIKSTYILKGHRNVGSTECPGNTFYNTVKTWPRFQA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 79/141 (56%)
pglyrp1XP_012823786.1 PGRP 51..192 CDD:128941 79/141 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130057
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4719
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.