DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and PGRP-SB2

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster


Alignment Length:117 Identity:46/117 - (39%)
Similarity:66/117 - (56%) Gaps:2/117 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVLFCAQAVLGVTIISKSEWGGRSATSK-TSLANYLSYAVIHHTAGNYCSTKAACITQLQNIQA 72
            ||::.|...:....|:.:|.|.....:.: ..|...:...:||||....|.....|...|:.|:|
  Fly     5 LALVLCGLTLALGQIVPRSSWCPVPISPRMPRLMVPVRLIIIHHTVTAPCFNPHQCQLVLRQIRA 69

  Fly    73 YHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNY 124
            .|| ...:.||||||||||||.:|||.|:.:.|.||..:||:||||:|:||:
  Fly    70 DHM-RRKFRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGNF 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 43/105 (41%)
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 43/104 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.