DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and PGRP-LF

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster


Alignment Length:161 Identity:64/161 - (39%)
Similarity:96/161 - (59%) Gaps:1/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GVTIISKSEWGGRSATSK-TSLANYLSYAVIHHTAGNYCSTKAACITQLQNIQAYHMDSLGWADI 83
            |:.|:.:|||.|...:.| ..|...:|..:|||||...|..:..||.:::.|||:||.|.||.||
  Fly    56 GLHILDRSEWLGEPPSGKYPHLKLPVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDI 120

  Fly    84 GYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAKGLLSDAVSRG 148
            |||||:||||.:|.||||::.|.|...:.:.|:.|:|:|.:......:.||.|||.|:.:.|...
  Fly   121 GYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDEGVRLH 185

  Fly   149 QIVSGYILYGHRQVGSTECPGTNIWNEIRTW 179
            ::...|.:|.|||:..||.||..::..::.|
  Fly   186 RLQPDYHIYAHRQLSPTESPGQKLFELMQNW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 57/141 (40%)
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 57/141 (40%)
PGRP 236..363 CDD:295442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6354
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.