DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and PGRP-LA

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster


Alignment Length:171 Identity:47/171 - (27%)
Similarity:77/171 - (45%) Gaps:16/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GVTIISKSEWGGRSATSKTS------LANYLSYAVIHHTAGNY--CSTKAACITQLQNIQAYHMD 76
            |..::.:.:||    .||.|      |...:.|.:|.|.....  |.....|..:::.||...:.
  Fly   180 GHLVVDREQWG----ASKNSHGLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAIA 240

  Fly    77 SLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAKGLL 141
            ..|..||..||.:..:||:|.||||:    .|..:.::::.|:|:|:|........|:...:.||
  Fly   241 EKGLPDIQSNFYVSEEGNIYVGRGWD----WANTYANQTLAITFMGDYGRFKPGPKQLEGVQFLL 301

  Fly   142 SDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNW 182
            :.||:...|...|.|....|...|..||..::.|||.|.::
  Fly   302 AHAVANRNIDVDYKLVAQNQTKVTRSPGAYVYQEIRNWPHF 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 38/148 (26%)
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.