DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and PGRP-SD

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster


Alignment Length:177 Identity:74/177 - (41%)
Similarity:102/177 - (57%) Gaps:2/177 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAVLFCAQAVLG-VTIISKSEWGGRSATSK-TSLANYLSYAVIHHTAGNYCSTKAACITQLQNI 70
            ||.|...|.||.| |.|::::||..:..... .|:...|..|||.||||..|:....|...:||:
  Fly     6 LLIVGLTAIAVQGEVPIVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNL 70

  Fly    71 QAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQIT 135
            |.:.|....::||||::||||:|.|||||..:..||.|...|..|:||:|:||:.........:.
  Fly    71 QNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALD 135

  Fly   136 AAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNW 182
            |||.||..||.:.|:|.||.|.|||||.:|:.||..::..|:.|.||
  Fly   136 AAKELLEQAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 58/141 (41%)
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 58/141 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440261
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.