DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and PGRP-LD

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001137893.1 Gene:PGRP-LD / 3771920 FlyBaseID:FBgn0260458 Length:327 Species:Drosophila melanogaster


Alignment Length:191 Identity:45/191 - (23%)
Similarity:84/191 - (43%) Gaps:23/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANKALILLAVLFCAQAV-----LGVTIISKSEWGGRSATSKTSLANYLSY--AVIHHTAGNYCS 58
            |...||.|.|.|...|..     ..::|:....|.......:.:|.:.:..  .:..||..|.|.
  Fly   144 MCASALALAAYLLWRQTQTPDFGYRLSIVGHGIWSDMELQGRGTLFDPIGVGTVIFTHTGSNECH 208

  Fly    59 TKAACITQLQNIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNS-KSIGISFLG 122
            ..  |...|..::..|:     .::.||||:.||..|:|.:||:....:..:.|. .|:.::|:|
  Fly   209 DD--CPDVLHKLERSHV-----GELPYNFLVAGDCQVFEAQGWHYRSQYPRDLNGIDSLVMAFVG 266

  Fly   123 NYNTNTLTSAQITAAKGLLSDAVSRGQIVSGYILYGHRQVGS-TECPGTNIWNEIRTWSNW 182
            |::.......|:.||:.|:.:::.|..:...|.|:   .:|| |:.    :..|:|.|.::
  Fly   267 NFSGRPPIDCQLMAAQALILESLKRRILQPIYQLF---VLGSYTDA----LQRELRHWPHY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 32/143 (22%)
PGRP-LDNP_001137893.1 PGRP 169..306 CDD:128941 33/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.