DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and Pglyrp4

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_038958226.1 Gene:Pglyrp4 / 310611 RGDID:1308520 Length:384 Species:Rattus norvegicus


Alignment Length:162 Identity:65/162 - (40%)
Similarity:97/162 - (59%) Gaps:3/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IISKSEWGGR-SATSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQNIQAYHMDSLGWADIGYN 86
            |:.:|.||.| |...|.:|.  ..||:|.||||..||....|...:|::|::.||.|...|||||
  Rat   224 IVPRSAWGARESHCFKMTLP--AKYAIILHTAGRTCSQPDECRLLIQDLQSFFMDRLNACDIGYN 286

  Fly    87 FLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAKGLLSDAVSRGQIV 151
            ||:|.||.||||.|||..|:....:|..::.|:|:|.:..::..:|.:.||:.|:..||.:|.:.
  Rat   287 FLVGQDGGVYEGVGWNNQGSKTDGYNDIALSIAFMGIFTGSSPNAAALQAAQDLIQCAVVKGYLT 351

  Fly   152 SGYILYGHRQVGSTECPGTNIWNEIRTWSNWK 183
            ..|:|.||..|.:|..||..::|.|:||.::|
  Rat   352 PNYLLMGHSDVSNTLSPGQALYNIIKTWPHFK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 56/139 (40%)
Pglyrp4XP_038958226.1 PGRP 67..201 CDD:128941
PGRP 222..362 CDD:128941 56/139 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130057
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.