DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and Pglyrp2

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_038935975.1 Gene:Pglyrp2 / 299567 RGDID:1359183 Length:522 Species:Rattus norvegicus


Alignment Length:193 Identity:69/193 - (35%)
Similarity:108/193 - (55%) Gaps:14/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANKALILLAVLFC---AQAVLGVTII-SKSEWGGRSATS-KTSLANYLSYAVIHHTAGNY---- 56
            |:.|.|..:|....   .:|.||...| .:..||...... .|.|...|....:|||   |    
  Rat   328 MSQKQLAQVATFATKEFTEAFLGCPAIHPRCRWGAAPYRGHPTPLRLPLGLLYVHHT---YVPAP 389

  Fly    57 -CSTKAACITQLQNIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISF 120
             |:|..:|...::::|.:|.:..|||||||:|::|.||.||:||||:.:|||...:||:..|::|
  Rat   390 PCTTFQSCAADMRSMQRFHQNVRGWADIGYSFVVGSDGYVYQGRGWHWVGAHTLGYNSRGFGVAF 454

  Fly   121 LGNYNTNTLTSAQITAAKGLL-SDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNW 182
            :|||..:..:.|.:...:.:| |.|:..|.:...|.|:||||:|.|:|||..::|.:|||.::
  Rat   455 VGNYTGSLPSEAALNTVRDVLPSCAIRAGLLRPDYKLFGHRQLGKTDCPGNALFNLLRTWPHF 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 52/148 (35%)
Pglyrp2XP_038935975.1 PGRP 352..497 CDD:128941 52/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.