DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and mig-39

DIOPT Version :9

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_498871.3 Gene:mig-39 / 185686 WormBaseID:WBGene00018369 Length:943 Species:Caenorhabditis elegans


Alignment Length:131 Identity:38/131 - (29%)
Similarity:54/131 - (41%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GVTIISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQNI---QAYHMDSLGWA 81
            |:|:||:.||  ...|....|.|.....:.:.|......|....|.|:||:   ..||:     .
 Worm   656 GITLISEREW--NKVTGIHHLMNIFKPFMTYSTDMTTVDTVIPTIVQIQNVLEKDIYHL-----G 713

  Fly    82 DIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAKGLLSDAVS 146
            |||.:.|......|..     :|.....|::|..|..:.|......||||.|:|.||.|:...:|
 Worm   714 DIGSDLLTSLKQTVAP-----IMNPEHENFDSTYIQATALNPQLAVTLTSDQMTTAKSLIETEIS 773

  Fly   147 R 147
            |
 Worm   774 R 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 37/130 (28%)
mig-39NP_498871.3 Dimer_Tnp_hAT <866..>902 CDD:283379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.