DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1b and PGLYRP1

DIOPT Version :9

Sequence 1:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens


Alignment Length:161 Identity:79/161 - (49%)
Similarity:99/161 - (61%) Gaps:1/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGYNF 88
            :|.:.||....::....|...|.|.::.|||||.|.|.|.|....::||:|||.:|||.|:||||
Human    33 IVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNF 97

  Fly    89 LIGGDGNVYEGRGWNNMGAHAAE-WNPYSIGISFLGNYNWDTLEPNMISAAQQLLNDAVNRGQLS 152
            |||.||.||||||||..|||:.. |||.||||||:|||......|..|.|||.||...|.:|.|.
Human    98 LIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALR 162

  Fly   153 SGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            |.|:|.|||.|..|..||..:::.|:.|.|:
Human   163 SNYVLKGHRDVQRTLSPGNQLYHLIQNWPHY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 72/139 (52%)
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 72/139 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152330
Domainoid 1 1.000 147 1.000 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4200
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - mtm8604
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.