DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1b and Pglyrp1

DIOPT Version :9

Sequence 1:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_445825.1 Gene:Pglyrp1 / 84387 RGDID:621429 Length:183 Species:Rattus norvegicus


Alignment Length:162 Identity:69/162 - (42%)
Similarity:95/162 - (58%) Gaps:1/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YVVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGYN 87
            :||.::||....::.:.||...:.|.:|.|||||:|.:...|....::||.|.|..|||.|:.||
  Rat    20 FVVPRSEWKALPSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMKQLGWCDVAYN 84

  Fly    88 FLIGGDGNVYEGRGWNNMGAHAAE-WNPYSIGISFLGNYNWDTLEPNMISAAQQLLNDAVNRGQL 151
            ||||.||:|||||||...|.|... |||.||||:|:|:|:........:.||..||...|:.|.|
  Rat    85 FLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHRVPAKRALRAALNLLKCGVSEGFL 149

  Fly   152 SSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            .|.|.:.|||.|.:|..||..::..|:.|.|:
  Rat   150 RSNYEVKGHRDVQSTLSPGDQLYEIIQSWDHY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 62/140 (44%)
Pglyrp1NP_445825.1 PGRP 21..161 CDD:128941 62/139 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345828
Domainoid 1 1.000 128 1.000 Domainoid score I5179
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4342
OMA 1 1.010 - - QHG46811
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - mtm9085
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.