DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1b and pglyrp1-like.1

DIOPT Version :9

Sequence 1:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001025626.1 Gene:pglyrp1-like.1 / 595014 XenbaseID:XB-GENE-5778936 Length:182 Species:Xenopus tropicalis


Alignment Length:169 Identity:80/169 - (47%)
Similarity:111/169 - (65%) Gaps:5/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MAQGV-YVVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSYCETRAQCNAVLQSVQNYHMDSLGW 81
            :|||. .::|::.|||..:|....|...:.|.|||||||:.|.:.:.|.|..:::||:||.|.||
 Frog    14 LAQGCPKIISRSSWGGVPSKCQAKLPRSVKYVIIHHTAGASCNSESACKAQARNIQNFHMKSNGW 78

  Fly    82 PDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEPNMIS--AAQQLLND 144
            .|.|||||||.||.|||||||..:||||..:|..||||||:|.:.  ...||..:  ||:.|::.
 Frog    79 CDTGYNFLIGEDGQVYEGRGWETVGAHAKNYNFNSIGISFMGTFT--NRAPNTAAQKAAKDLISC 141

  Fly   145 AVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            .|.:..::|.|.|.|||.|||||||||:::|.|:.|.::
 Frog   142 GVAKKVINSDYTLKGHRDVSATECPGTNLYNLIKNWPNF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 65/143 (45%)
pglyrp1-like.1NP_001025626.1 PGRP 19..160 CDD:128941 65/142 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4426
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130057
Inparanoid 1 1.050 185 1.000 Inparanoid score I3811
OMA 1 1.010 - - QHG46811
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm48432
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.