DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1b and Pglyrp3

DIOPT Version :9

Sequence 1:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001178890.1 Gene:Pglyrp3 / 499658 RGDID:1593164 Length:339 Species:Rattus norvegicus


Alignment Length:141 Identity:59/141 - (41%)
Similarity:83/141 - (58%) Gaps:8/141 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YAIIHHTAGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAE 111
            :.||.||||..|...|.|...::..|::|||...:.||.|:||:|.||.||||.||...|:|...
  Rat   201 FVIIIHTAGESCNESADCLIRVRDTQSFHMDKQDFCDIAYHFLVGQDGVVYEGVGWTIEGSHTYG 265

  Fly   112 WNPYSIGISFLGNYNWDTLE--PN--MISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTH 172
            :|..::||:|:||:    :|  ||  .:.|||.|:..||..|.|:|.|:|.||..||....||..
  Rat   266 YNDIALGIAFMGNF----VEKPPNEASLEAAQSLIQCAVAMGYLASNYLLMGHSDVSNILSPGQA 326

  Fly   173 IWNEIRGWSHW 183
            ::|.|:.|.|:
  Rat   327 LYNIIKTWPHF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 51/119 (43%)
Pglyrp3NP_001178890.1 PGRP 19..152 CDD:128941
PGRP 177..317 CDD:128941 51/119 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9085
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.