DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1b and PGRP-LC

DIOPT Version :9

Sequence 1:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster


Alignment Length:138 Identity:47/138 - (34%)
Similarity:75/138 - (54%) Gaps:8/138 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TAGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHA--AEWNPY 115
            |....|.|:|.|...::.:|.|.::|....||.||||||||||||.|||||.||||.  ..::..
  Fly   385 TNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAHMNNINYDSQ 449

  Fly   116 SIGISFLGNYNWDTLEPN--MISAAQQLLNDAVNRGQLSSGYILYGHRQV--SATECPGTHIWNE 176
            |:..:::|::.  |::|:  .:|..:.||...|..|:::..|......::  |.|:.....::..
  Fly   450 SLSFAYIGSFK--TIQPSAKQLSVTRLLLERGVKLGKIAPSYRFTASSKLMPSVTDFKADALYAS 512

  Fly   177 IRGWSHWS 184
            ...|:|||
  Fly   513 FANWTHWS 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 41/113 (36%)
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 40/106 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.