DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1b and PGRP-SD

DIOPT Version :9

Sequence 1:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster


Alignment Length:182 Identity:72/182 - (39%)
Similarity:105/182 - (57%) Gaps:4/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VALLLAVLVCSQYMAQG-VYVVSKAEWGGRGAKWTV-GLGNYLSYAIIHHTAGSYCETRAQCNAV 67
            :.||:..|  :....|| |.:|::|||..:.....: .:...|..|:|.||||..|.....|:..
  Fly     4 IGLLIVGL--TAIAVQGEVPIVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQH 66

  Fly    68 LQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEP 132
            :|::||:.|....:.||||::||||:|.|||||..:..||.|...|..|:||:|:||:.......
  Fly    67 MQNLQNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNK 131

  Fly   133 NMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHWS 184
            ..:.||::||..||.:.||..||.|.||||||||:.||..::..|:.|.:||
  Fly   132 EALDAAKELLEQAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNWS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 56/141 (40%)
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 56/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.