DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1b and Pglyrp2

DIOPT Version :9

Sequence 1:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_038935975.1 Gene:Pglyrp2 / 299567 RGDID:1359183 Length:522 Species:Rattus norvegicus


Alignment Length:164 Identity:60/164 - (36%)
Similarity:92/164 - (56%) Gaps:8/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KAEWGG---RGAKWTVGLGNYLSYAIIHHT--AGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGY 86
            :..||.   ||....:.|...|.|  :|||  ....|.|...|.|.::|:|.:|.:..||.||||
  Rat   357 RCRWGAAPYRGHPTPLRLPLGLLY--VHHTYVPAPPCTTFQSCAADMRSMQRFHQNVRGWADIGY 419

  Fly    87 NFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEPNMISAAQQLL-NDAVNRGQ 150
            :|::|.||.||:||||:.:|||...:|....|::|:|||.........::..:.:| :.|:..|.
  Rat   420 SFVVGSDGYVYQGRGWHWVGAHTLGYNSRGFGVAFVGNYTGSLPSEAALNTVRDVLPSCAIRAGL 484

  Fly   151 LSSGYILYGHRQVSATECPGTHIWNEIRGWSHWS 184
            |...|.|:||||:..|:|||..::|.:|.|.|::
  Rat   485 LRPDYKLFGHRQLGKTDCPGNALFNLLRTWPHFT 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 51/141 (36%)
Pglyrp2XP_038935975.1 PGRP 352..497 CDD:128941 51/141 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345858
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMNT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.