DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1b and Pglyrp1

DIOPT Version :9

Sequence 1:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_033428.1 Gene:Pglyrp1 / 21946 MGIID:1345092 Length:182 Species:Mus musculus


Alignment Length:180 Identity:75/180 - (41%)
Similarity:105/180 - (58%) Gaps:8/180 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VALLLAVLVCSQYMAQGVYVVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSYCETRAQCNAVLQ 69
            :|||.....||       ::|.::||....::.:..||:.:.|.:|.|||||:|.:...|....:
Mouse     8 LALLGLATSCS-------FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQAR 65

  Fly    70 SVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAE-WNPYSIGISFLGNYNWDTLEPN 133
            :||:||.:.|||.|:.||||||.||:||||||||..|.|... |||.||||:|:||:........
Mouse    66 NVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKR 130

  Fly   134 MISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            .:.||..||...|:||.|.|.|.:.|||.|.:|..||..::..|:.|.|:
Mouse   131 ALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 63/141 (45%)
Pglyrp1NP_033428.1 PGRP 20..160 CDD:128941 63/139 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842397
Domainoid 1 1.000 132 1.000 Domainoid score I5082
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4341
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm44042
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.