DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1b and PGLYRP2

DIOPT Version :9

Sequence 1:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens


Alignment Length:168 Identity:63/168 - (37%)
Similarity:90/168 - (53%) Gaps:16/168 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KAEWGG---RGAKWTVGLGNYLSYAIIHHT--AGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGY 86
            :..||.   ||....:.|.  |.:..:|||  ....|....:|.|.::|:|.||.|:.||.||||
Human   385 RCRWGAAPYRGRPKLLQLP--LGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGY 447

  Fly    87 NFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEPNMISAAQQLLND-----AV 146
            :|::|.||.|||||||:.:|||....|....|::.:|||.  ...|.  .||.:.:.|     ||
Human   448 SFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYT--AALPT--EAALRTVRDTLPSCAV 508

  Fly   147 NRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHWS 184
            ..|.|...|.|.||||:..|:|||..:::.:|.|.|::
Human   509 RAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFT 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 55/145 (38%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 55/145 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152350
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMNT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.