DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14743 and Slc24a1

DIOPT Version :10

Sequence 1:NP_610408.2 Gene:CG14743 / 35860 FlyBaseID:FBgn0033326 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_064475.1 Gene:Slc24a1 / 56814 RGDID:620080 Length:1181 Species:Rattus norvegicus


Alignment Length:224 Identity:58/224 - (25%)
Similarity:101/224 - (45%) Gaps:23/224 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FKIDNKITEIVVMLLFALIYCFF-LCILYEGVNSYFAPTLKIAALKMRINEYMAGVVLVGVANST 127
            |.::::....||:.:|.:.|.|. |.|:   .:.||.|.|.:...|::|:|.:||...:....|.
  Rat   412 FSVEDRRQGWVVLHIFGMTYVFVALAIV---CDEYFVPALGVITDKLQISEDVAGATFMAAGGSA 473

  Fly   128 PDLLVNLSPVRME------GLTFNIAMANALTIICLSGGAVCFIRP-FRMNGHSIFRDLLFLLLI 185
            |:|..:|..|.:.      |.....|:.|.|.:|   |....|.|. ..:....:|||:.|.:|.
  Rat   474 PELFTSLIGVFISHSNVGIGTIVGSAVFNILFVI---GTCALFSREILNLTWWPLFRDVSFYILD 535

  Fly   186 IELVRFFMNDTALAPWIKGAILLSIYPIYLLINIVDLILLRYAIRKL--RADIEVLRQSPSSREH 248
            :.::..|..|:.:| |.:..:||..|.:|:.....:..:.|:...:|  |...:|:.....|:..
  Rat   536 LSMLIVFFLDSLIA-WWESLLLLLAYALYVFTMKWNKQIERWVKEQLSRRPVAKVMALGDLSKPS 599

  Fly   249 DLILTEKIVRLNNLQQDDEIQILESKLYR 277
            |..:.|      |.|||::...|.|.|.|
  Rat   600 DGAIEE------NEQQDNKKLKLPSVLTR 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14743NP_610408.2 ECM27 106..>221 CDD:440296 31/121 (26%)
PLN03151 <337..529 CDD:215604
Na_Ca_ex 450..591 CDD:426387
Slc24a1NP_064475.1 2A1904 1..1181 CDD:273344 58/224 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..232
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..276
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..323
Alpha-1 461..501 9/39 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 598..617 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 650..983
14 X approximate tandem repeats 730..905
Alpha-2 1061..1092
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.