DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14743 and slc8b1

DIOPT Version :9

Sequence 1:NP_610408.2 Gene:CG14743 / 35860 FlyBaseID:FBgn0033326 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_021333605.1 Gene:slc8b1 / 560601 ZFINID:ZDB-GENE-130530-900 Length:301 Species:Danio rerio


Alignment Length:242 Identity:61/242 - (25%)
Similarity:97/242 - (40%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLAVMHFSYLHRCEMATKIDDCKYITNFFNYYVMMYCSFK---IDNKITEIVVMLLFALIYCFFL 87
            |..||:.|...|||......||.....|..|..:.:|.|.   :...||..|:.|||..:     
Zfish    55 CDVVMNVSASQRCEYVKNTPDCASDEGFIKYPFVTFCLFTPSLLPLAITIYVIWLLFLFL----- 114

  Fly    88 CILYEGVNSYFAPTLKIAALKMRINEYMAGVVLVGVANSTPDL---LVNLSPVRMEGLTFNIAMA 149
             :|....:.:|.|.|...|..:|:...:|||..:.:.|..||:   :...|..:..||.......
Zfish   115 -VLGLIASDFFCPNLSAIASTLRLTHNVAGVTFLALGNGAPDVFSAMAAFSHPQTAGLAIGALFG 178

  Fly   150 NALTIICLSGGAVCFIRPFRMNGHSIFRDLLFLLLIIELVRFFMNDTALAPWIKGAILLSIYPIY 214
            ..:.:..:..|:|..::||.:......||::|.:..:     |...|.|   .||.|.|.....|
Zfish   179 AGIFVTTVVAGSVALVKPFTVASRPFLRDVIFYMAAV-----FWTFTVL---YKGHISLGESVGY 235

  Fly   215 L---LINIVDLILLRYAIRKLRADIEVLRQSP--SSREHDLILTEKI 256
            |   :..:..:||..|...:.:   ..|.:||  |.||...||:..:
Zfish   236 LGMYIAYVFTVILSSYIYNRQK---HQLTESPQSSDREQGGILSSDL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14743NP_610408.2 Na_Ca_ex 77..220 CDD:279963 34/148 (23%)
Na_Ca_ex 450..591 CDD:279963
slc8b1XP_021333605.1 Na_Ca_ex 66..>246 CDD:332332 46/193 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41602
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257493at33208
OrthoFinder 1 1.000 - - FOG0000933
OrthoInspector 1 1.000 - - otm26516
orthoMCL 1 0.900 - - OOG6_101277
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X612
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.