DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14743 and slc8b1

DIOPT Version :9

Sequence 1:NP_610408.2 Gene:CG14743 / 35860 FlyBaseID:FBgn0033326 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001017082.1 Gene:slc8b1 / 549836 XenbaseID:XB-GENE-957176 Length:238 Species:Xenopus tropicalis


Alignment Length:229 Identity:53/229 - (23%)
Similarity:91/229 - (39%) Gaps:22/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLKYLINTSP--YSFLNESDFMQN-VSCLAVMHFSYLHRCEMATKIDDCKYITNFFNYYVMMYCS 63
            |.::||...|  |||    :.:|| ..|..|.......||.......||.....:.||....:||
 Frog    19 SAEFLIGMEPLNYSF----NSVQNKADCQEVGKLDASLRCNFTRTTPDCSVGDGYINYLDGAFCS 79

  Fly    64 FKIDNKITEIVVMLLFA----LIYCFFLCILYEGVNSYFAPTLKIAALKMRINEYMAGVVLVGVA 124
            |     :..:..:.:|.    |:|.|.  ||......:|.|.|...:..:|::..:|||..:...
 Frog    80 F-----LPSLFPLAIFLYTLWLLYLFI--ILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFG 137

  Fly   125 NSTPDL---LVNLSPVRMEGLTFNIAMANALTIICLSGGAVCFIRPFRMNGHSIFRDLLFLLLII 186
            |..||:   :...|..|..||.........:.:..:..|.:..::||........||::|.:..|
 Frog   138 NGAPDVFSAVAAFSDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAI 202

  Fly   187 ELVRFFMNDTALAPWIKGAILLSIYPIYLLINIV 220
            .|. ||:.........:..:.|.:|.:|:.:.::
 Frog   203 FLT-FFILYQGFVTLAEALVYLLLYLVYVFVVVI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14743NP_610408.2 Na_Ca_ex 77..220 CDD:279963 33/149 (22%)
Na_Ca_ex 450..591 CDD:279963
slc8b1NP_001017082.1 Na_Ca_ex 94..219 CDD:279963 29/127 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8955
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41602
Inparanoid 1 1.050 205 1.000 Inparanoid score I3626
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257493at33208
OrthoFinder 1 1.000 - - FOG0000933
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X612
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.