DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14743 and Nckx30C

DIOPT Version :10

Sequence 1:NP_610408.2 Gene:CG14743 / 35860 FlyBaseID:FBgn0033326 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_652011.3 Gene:Nckx30C / 45248 FlyBaseID:FBgn0028704 Length:881 Species:Drosophila melanogaster


Alignment Length:173 Identity:39/173 - (22%)
Similarity:71/173 - (41%) Gaps:52/173 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 IEDLKCQ-MKKLQESK-----REDRKKLADEEALRKIKQ----LEEQKYELQKQVQNQKQPPDSS 802
            :|||:.. |||...:|     ::..|..:.|.:.|:..|    :..:||...:.:.:::|     
  Fly   365 VEDLQFDVMKKTYAAKPISPPKQKPKPPSTETSSREDHQGWISISSRKYHQVRTIAHRQQ----- 424

  Fly   803 WSSGYRPFEEEALLNEMEVTGQAFEDMQEQNSRLIQQLREKDDANFKLMSDRIKANQMHKLLREE 867
               |.|.||.....|.:      :.|..::::...||   :|...||.:| :.||          
  Fly   425 ---GRRKFESINKFNAL------YLDDGDEDTVAHQQ---RDHHTFKSIS-KFKA---------- 466

  Fly   868 KQLLEDQVTT--RDSQIEAMHVVLRKLEEKERILQNTVTTIEK 908
            ::||:|...|  :.|:.:..|            |||.||.:.:
  Fly   467 QRLLDDDEFTGVKTSKCDTSH------------LQNRVTAVHE 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14743NP_610408.2 ECM27 106..>221 CDD:440296
PLN03151 <337..529 CDD:215604
Na_Ca_ex 450..591 CDD:426387
Nckx30CNP_652011.3 2A1904 <318..880 CDD:273344 39/173 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.