DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and pglyrp6

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001038687.2 Gene:pglyrp6 / 571817 ZFINID:ZDB-GENE-071227-2 Length:498 Species:Danio rerio


Alignment Length:170 Identity:73/170 - (42%)
Similarity:101/170 - (59%) Gaps:16/170 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VVSKAEWGGRGAKWTVGLGNYLS----YAIIHHT--AGSYCETRAQCNAVLQSVQNYHMDSLGWP 82
            ::::::|   ||...:|..:|||    |..||||  ....|.|..||.|.::|:|.||..|.||.
Zfish   330 IITRSQW---GAASYIGSPSYLSLPVRYLFIHHTYQPSKPCTTFEQCAAEMRSMQRYHQQSNGWS 391

  Fly    83 DIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEPNMISAAQQLLND--- 144
            ||||:|:.|.|||:|||||||.:|||...:|....|:.|:|:|. .||..:  ||...:..|   
Zfish   392 DIGYSFVAGSDGNLYEGRGWNWVGAHTYGYNSIGYGVCFIGDYT-STLPAS--SAMNMVRYDFTY 453

  Fly   145 -AVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
             |.|.|:||..|.||||||.:||||||..::.:|:.|..:
Zfish   454 CATNGGRLSKSYSLYGHRQAAATECPGNTLYRQIQTWERY 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 64/148 (43%)
pglyrp6NP_001038687.2 PGRP 328..472 CDD:128941 63/147 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586836
Domainoid 1 1.000 129 1.000 Domainoid score I5198
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.