DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and pglyrp1

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_012823786.1 Gene:pglyrp1 / 548492 XenbaseID:XB-GENE-491319 Length:214 Species:Xenopus tropicalis


Alignment Length:159 Identity:75/159 - (47%)
Similarity:107/159 - (67%) Gaps:4/159 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGYNF 88
            :::||:||||.|.....:...:.|.|||||||::|.::..|.:..:|:|||||:|..|.|:||:|
 Frog    53 ILTKAQWGGRAATCRTAMTTPVPYVIIHHTAGAHCSSQTSCISQAKSIQNYHMNSNAWCDVGYSF 117

  Fly    89 LIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEPNMI--SAAQQLLNDAVNRGQL 151
            |:|.|||||||||||::||||..:|..|||||.:|.|.  .:.||..  :|.:.|::..|.:|.:
 Frog   118 LVGEDGNVYEGRGWNSVGAHAPNYNSNSIGISVMGTYT--NINPNTAAQNAVKNLISCGVTKGYI 180

  Fly   152 SSGYILYGHRQVSATECPGTHIWNEIRGW 180
            .|.|||.|||.|.:|||||...:|.::.|
 Frog   181 KSTYILKGHRNVGSTECPGNTFYNTVKTW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 67/140 (48%)
pglyrp1XP_012823786.1 PGRP 51..192 CDD:128941 67/140 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130057
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.