DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and PGRP-LB

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster


Alignment Length:182 Identity:70/182 - (38%)
Similarity:102/182 - (56%) Gaps:15/182 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SQYMAQ-----GV---YVVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSY----CETRAQCNAV 67
            ||:|.|     ||   .::|:::||.|..|..........|.||||   ||    |.:...|...
  Fly    38 SQHMQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHH---SYMPAVCYSTPDCMKS 99

  Fly    68 LQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEP 132
            ::.:|::|....||.||||:|.|||||.:|.|||:|.:||||.::|..|:||..:|::..:....
  Fly   100 MRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPK 164

  Fly   133 NMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHWS 184
            .|:.||:.|:...|.:|.:...|.|.|||||..|||||..::.||..|.|::
  Fly   165 QMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFT 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 54/147 (37%)
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 53/144 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMNT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.