DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and PGRP-LA

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster


Alignment Length:176 Identity:51/176 - (28%)
Similarity:81/176 - (46%) Gaps:16/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MAQGVYVVSKAEWGG--RGAKWTVGLGNYLSYAIIHH--TAGSYCETRAQCNAVLQSVQNYHMDS 78
            :..|..||.:.:||.  .....|:.|...:.|.:|.|  .....|:...:|:..::::|:..:..
  Fly   177 LGNGHLVVDREQWGASKNSHGLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAIAE 241

  Fly    79 LGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEW-NPY---SIGISFLGNYNWDTLEPNMISAAQ 139
            .|.|||..||.:..:||:|.||||        :| |.|   ::.|:|:|:|......|..:...|
  Fly   242 KGLPDIQSNFYVSEEGNIYVGRGW--------DWANTYANQTLAITFMGDYGRFKPGPKQLEGVQ 298

  Fly   140 QLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHWSG 185
            .||..||....:...|.|....|...|..||.:::.|||.|.|:.|
  Fly   299 FLLAHAVANRNIDVDYKLVAQNQTKVTRSPGAYVYQEIRNWPHFYG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 40/148 (27%)
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.