DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and PGRP-LD

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001137893.1 Gene:PGRP-LD / 3771920 FlyBaseID:FBgn0260458 Length:327 Species:Drosophila melanogaster


Alignment Length:199 Identity:48/199 - (24%)
Similarity:87/199 - (43%) Gaps:44/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLVCSQYMAQGVYVV---------------------SKAEWGGRGAKW-TVGLGNYLSYAIIHHT 53
            :::|:..:|...|::                     |..|..|||..: .:|:|.    .|..||
  Fly   142 LVMCASALALAAYLLWRQTQTPDFGYRLSIVGHGIWSDMELQGRGTLFDPIGVGT----VIFTHT 202

  Fly    54 AGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPY-SI 117
            ..:.|..  .|..||..::..|:.     ::.||||:.||..|:|.:||:....:..:.|.. |:
  Fly   203 GSNECHD--DCPDVLHKLERSHVG-----ELPYNFLVAGDCQVFEAQGWHYRSQYPRDLNGIDSL 260

  Fly   118 GISFLGNYNWDTLEPNMISAAQQLLNDAVNRGQLSSGYILY--GHRQVSATECPGTHIWNEIRGW 180
            .::|:||::........:.|||.|:.:::.|..|...|.|:  |    |.|:.    :..|:|.|
  Fly   261 VMAFVGNFSGRPPIDCQLMAAQALILESLKRRILQPIYQLFVLG----SYTDA----LQRELRHW 317

  Fly   181 SHWS 184
            .|::
  Fly   318 PHYA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 40/165 (24%)
PGRP-LDNP_001137893.1 PGRP 169..306 CDD:128941 39/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.