DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and PGRP-SC2

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster


Alignment Length:183 Identity:126/183 - (68%)
Similarity:147/183 - (80%) Gaps:1/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSKVALLLAVLVCSQYMAQGVYVVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSYCETRAQCN 65
            |.:|..:|||||.|:|.:. ||.::||:|||||.|.....|.||||||:||||||:||.|:|.|.
  Fly     1 MANKALILLAVLFCAQAVL-GVTIISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCSTKAACI 64

  Fly    66 AVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTL 130
            ..||::|.||||||||.|||||||||||||||||||||.|||||..||..|||||||||||.:||
  Fly    65 TQLQNIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTL 129

  Fly   131 EPNMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            ....|:||:.||:|||:|||:.|||||||||||.:||||||:||||||.||:|
  Fly   130 TSAQITAAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 99/140 (71%)
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 99/140 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440235
Domainoid 1 1.000 129 1.000 Domainoid score I5198
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130057
Inparanoid 1 1.050 136 1.000 Inparanoid score I4536
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1649
1110.900

Return to query results.
Submit another query.