DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and PGRP-SA

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster


Alignment Length:190 Identity:73/190 - (38%)
Similarity:102/190 - (53%) Gaps:12/190 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSKVALLLAVLVCSQYM----AQGVYVVSKAEWGGRGAKWTVGLGNY----LSYAIIHHTAGSYC 58
            :..|.||||.:...:..    |....:..|.:|||   |.::|| :|    :.|.:||||....|
  Fly    14 IGLVLLLLAFVSAGKSRQRSPANCPTIKLKRQWGG---KPSLGL-HYQVRPIRYVVIHHTVTGEC 74

  Fly    59 ETRAQCNAVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLG 123
            ....:|..:||::|.||.:.|.:.||.||||||.||.||||.||...|||...:|....||:|:|
  Fly    75 SGLLKCAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIG 139

  Fly   124 NYNWDTLEPNMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            |:.........:.||:.||...|.:|:||..|.|....||.:|:.||..::|||:.|.||
  Fly   140 NFVDKLPSDAALQAAKDLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 56/144 (39%)
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 56/144 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm44042
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1649
87.850

Return to query results.
Submit another query.