DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and Pglyrp2

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_038935975.1 Gene:Pglyrp2 / 299567 RGDID:1359183 Length:522 Species:Rattus norvegicus


Alignment Length:164 Identity:60/164 - (36%)
Similarity:92/164 - (56%) Gaps:8/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KAEWGG---RGAKWTVGLGNYLSYAIIHHT--AGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGY 86
            :..||.   ||....:.|...|.|  :|||  ....|.|...|.|.::|:|.:|.:..||.||||
  Rat   357 RCRWGAAPYRGHPTPLRLPLGLLY--VHHTYVPAPPCTTFQSCAADMRSMQRFHQNVRGWADIGY 419

  Fly    87 NFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEPNMISAAQQLL-NDAVNRGQ 150
            :|::|.||.||:||||:.:|||...:|....|::|:|||.........::..:.:| :.|:..|.
  Rat   420 SFVVGSDGYVYQGRGWHWVGAHTLGYNSRGFGVAFVGNYTGSLPSEAALNTVRDVLPSCAIRAGL 484

  Fly   151 LSSGYILYGHRQVSATECPGTHIWNEIRGWSHWS 184
            |...|.|:||||:..|:|||..::|.:|.|.|::
  Rat   485 LRPDYKLFGHRQLGKTDCPGNALFNLLRTWPHFT 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 51/141 (36%)
Pglyrp2XP_038935975.1 PGRP 352..497 CDD:128941 51/141 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMNT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.