DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and PGLYRP3

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_011507420.1 Gene:PGLYRP3 / 114771 HGNCID:30014 Length:377 Species:Homo sapiens


Alignment Length:173 Identity:62/173 - (35%)
Similarity:93/173 - (53%) Gaps:27/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VVSKAEWGGR---------GAKWTVGLGNYLSYAIIHHTAGSYCETRAQCNAVLQSVQNYHMDSL 79
            ::.::.|..|         .||          |.||.||||:.|.....|..|::::|::|||:.
Human   217 IIKRSAWEARETHCPKMNLPAK----------YVIIIHTAGTSCTVSTDCQTVVRNIQSFHMDTR 271

  Fly    80 GWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLE--PN--MISAAQQ 140
            .:.||||:||:|.||.||||.||:..|:|...:|..::||:|:|.:    :|  ||  .:.|||.
Human   272 NFCDIGYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGYF----VEKPPNAAALEAAQD 332

  Fly   141 LLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            |:..||..|.|:..|:|.||..|.....||..::|.|..|.|:
Human   333 LIQCAVVEGYLTPNYLLMGHSDVVNILSPGQALYNIISTWPHF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 55/151 (36%)
PGLYRP3XP_011507420.1 PGRP 57..195 CDD:128941
PGRP 215..355 CDD:128941 55/151 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8604
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.