DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and pglyrp2

DIOPT Version :9

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001106487.2 Gene:pglyrp2 / 100127677 XenbaseID:XB-GENE-5779913 Length:497 Species:Xenopus tropicalis


Alignment Length:184 Identity:68/184 - (36%)
Similarity:103/184 - (55%) Gaps:4/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVALLLAVLVCSQYMAQGVYVVSKAEWGGRGAKW-TVGLGNYLSYAIIHHT--AGSYCETRAQCN 65
            |:|...|.....||......|:.:..||.:..|. .:.||..||...||||  ....|.:.:||.
 Frog   311 KIAAGAAAREFEQYFLDCPAVIPRCMWGAKRYKGKPIFLGLPLSRVFIHHTYEPSQPCTSFSQCA 375

  Fly    66 AVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTL 130
            |.::|:|.:|....||.||||:|::|.:|.:|||||||..|||...:|....|:||:|:|.....
 Frog   376 ANMRSMQRFHQQDRGWDDIGYSFVVGSNGYLYEGRGWNRAGAHTRGYNSVGYGVSFIGDYTSIVP 440

  Fly   131 EPNMISAAQ-QLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            :.::::..: :.|..||..|.::..||:.|||||.:|.|||..::.||:.|.|:
 Frog   441 KDSILALVKDRFLRCAVRLGYITPNYIIQGHRQVVSTSCPGDALYKEIQSWDHF 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 53/144 (37%)
pglyrp2NP_001106487.2 PGRP 329..474 CDD:128941 53/144 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.