DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14744 and slc8b1

DIOPT Version :9

Sequence 1:NP_001097232.2 Gene:CG14744 / 35858 FlyBaseID:FBgn0033324 Length:620 Species:Drosophila melanogaster
Sequence 2:XP_021333605.1 Gene:slc8b1 / 560601 ZFINID:ZDB-GENE-130530-900 Length:301 Species:Danio rerio


Alignment Length:222 Identity:56/222 - (25%)
Similarity:96/222 - (43%) Gaps:19/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KNMSCRAVMRLPYNYRCRMATQVSDCKRIINFFNYFRMMYCSID---IDDKATEVLFMLLFAFIC 85
            |...|..||.:..:.||.......||.....|..|..:.:|...   :....|..:..|||.|:.
Zfish    51 KGDECDVVMNVSASQRCEYVKNTPDCASDEGFIKYPFVTFCLFTPSLLPLAITIYVIWLLFLFLV 115

  Fly    86 VAFLWLMSFNIGTYFSPVLKIISLKLHMNEYLAGVTFLAFGNCSPEIIANLM----PVRADAPIF 146
            :..:      ...:|.|.|..|:..|.:...:|||||||.||.:|::.:.:.    |..|...|.
Zfish   116 LGLI------ASDFFCPNLSAIASTLRLTHNVAGVTFLALGNGAPDVFSAMAAFSHPQTAGLAIG 174

  Fly   147 TITVGNTLAIILLSGGTVCFLRPFRMNGHSTLRDLLFLLLGVEVLRFVMIKEGAVTLGEGIVLFL 211
            .: .|..:.:..:..|:|..::||.:.....|||::|.:..| ...|.::.:|.::|||.:....
Zfish   175 AL-FGAGIFVTTVVAGSVALVKPFTVASRPFLRDVIFYMAAV-FWTFTVLYKGHISLGESVGYLG 237

  Fly   212 IYVVYVAINIADLALLRYYIRKLRREL 238
            :|:.||...|    |..|...:.:.:|
Zfish   238 MYIAYVFTVI----LSSYIYNRQKHQL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14744NP_001097232.2 Na_Ca_ex 79..221 CDD:279963 40/145 (28%)
Na_Ca_ex 450..601 CDD:279963
slc8b1XP_021333605.1 Na_Ca_ex 66..>246 CDD:332332 48/187 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41602
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257493at33208
OrthoFinder 1 1.000 - - FOG0000933
OrthoInspector 1 1.000 - - otm26516
orthoMCL 1 0.900 - - OOG6_101277
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X612
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.