DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14744 and slc24a4a

DIOPT Version :9

Sequence 1:NP_001097232.2 Gene:CG14744 / 35858 FlyBaseID:FBgn0033324 Length:620 Species:Drosophila melanogaster
Sequence 2:XP_005158898.1 Gene:slc24a4a / 550467 ZFINID:ZDB-GENE-050417-291 Length:621 Species:Danio rerio


Alignment Length:603 Identity:127/603 - (21%)
Similarity:229/603 - (37%) Gaps:187/603 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LFMLLFAFICVAFLWLMSFNIGTYFSPVLKIISLKLHMNEYLAGVTFLAFGNCSPEIIANLMPV- 139
            :|..|:.|:.:|.:      ...||...|:.|..|||::|.:||.||:|.|:.:||:.|:::.| 
Zfish   121 IFAALYMFLALAIV------CDDYFVTSLEKICEKLHLSEDVAGATFMAAGSSAPELFASIIGVF 179

  Fly   140 --RADAPIFTI---TVGNTLAIILLSG---GTVCFLRPFRMNGHSTLRDLLFLLLGVEVLRFVMI 196
              ..|..:.||   .|.|.|.||.:.|   |.|.||..:     :..||..:.::.|..| .|.|
Zfish   180 ITHGDVGVGTIVGSAVFNILCIIGVCGIFAGQVVFLTKY-----AVFRDSSYYIISVIAL-IVFI 238

  Fly   197 KEGAVTLGEGIVLFLIYVVYVAINIADLALLRYYIRKLRRELDYLEGLTPPPITEINAKIRKLIS 261
            .:..:...|.:||.::|:.|:.                              :.:.|..::.|.:
Zfish   239 YDDEILWWESLVLIVMYLGYII------------------------------VMKFNTSLQNLFN 273

  Fly   262 WEEQDDIGIKDTTKYRRSRDTGNHFSNMTSSGYFVTPIPERRSEHVDYELNRTALHDSENPKNLQ 326
            .:|...:                                          .|..|:.....|.| .
Zfish   274 GKEDKRV------------------------------------------TNGNAVSSEMEPGN-D 295

  Fly   327 LFTEFFQSLNPVDAEAWQLGG--WSNRIYLIARCPLVFVLQLFIPVVDYEKIKHGWSKLLNCTQI 389
            .|.:|:      |..:|.|..  ..|:||  .|..:|.|.::......:.:......:::     
Zfish   296 CFEQFW------DDPSWPLLAPVKPNKIY--TRGSVVMVDEMMNSSPPHYRFPEAGLRVM----- 347

  Fly   390 VTNPF-----------VVIT----LVHS--GVSSV---------YKTWHI--------------- 413
            :||.|           ::|.    ||.|  ||.||         .:..::               
Zfish   348 ITNHFGPKTRLRMASRLIINEQQRLVKSANGVDSVLVSDQKADTMENGNVAEDKLSEEQENEISP 412

  Fly   414 ---------TLDFSISMWSPCLTVPLAIVIFLHSRTDVPPSYHHLFIILTFFSSMVTLWLAVTE- 468
                     |:.|.|| |      |::::::..........:...| :|:||.|  |:|:|... 
Zfish   413 FRLPEGAMDTVKFFIS-W------PISLLLYFTIPNCAKKRWECCF-MLSFFLS--TVWIAAFSY 467

  Fly   469 -LEVLSEIVGIVFNLSESFMAVTFEAVSNATPDIIANYQLALQGYGRMAFAAIIGGPVFAILVSM 532
             |..:..|||....:.:..|.:||.|...:.||.||:..:|.||.|.||.:..||..||.|||.:
Zfish   468 ILVWMVTIVGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGL 532

  Fly   533 SLAFIFNHRVREVGANSWVYGD---LGDNCYLFLVITIVTTMWWSVTFDFHARR-----SAGVFL 589
            .:.:    .::.:..|   ||.   :.....::.|:.::.::..:| ...|..|     ..|:::
Zfish   533 GVPW----GIQTMAVN---YGSVVKINSRGLVYSVVLLLGSVALTV-LGIHVNRWRLDLRLGIYV 589

  Fly   590 WLVYLQFLLYAVCVEWDV 607
            .::|..||.:::.:|::|
Zfish   590 LVLYAIFLTFSIMIEYNV 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14744NP_001097232.2 Na_Ca_ex 79..221 CDD:279963 45/150 (30%)
Na_Ca_ex 450..601 CDD:279963 44/160 (28%)
slc24a4aXP_005158898.1 TIGR00367 119..596 CDD:273039 123/590 (21%)
Na_Ca_ex 120..262 CDD:279963 46/182 (25%)
Na_Ca_ex 451..602 CDD:279963 44/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.