DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14744 and CG12061

DIOPT Version :9

Sequence 1:NP_001097232.2 Gene:CG14744 / 35858 FlyBaseID:FBgn0033324 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_001104467.2 Gene:CG12061 / 3354990 FlyBaseID:FBgn0040031 Length:441 Species:Drosophila melanogaster


Alignment Length:610 Identity:115/610 - (18%)
Similarity:205/610 - (33%) Gaps:218/610 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HEFHYFIKNMSCRAVMRLPYNYRCRMATQVS--DC--KRIINFFNYFRM-MYCSIDIDDKATEVL 76
            :|:.|:            |:.||..|...:.  :|  ..|:.|.|..|. .:.:|.:....:..|
  Fly    15 NEWEYY------------PFAYRHDMRYDIDARNCTLPAIVEFPNLMRQKSWIAIVVSTLVSMYL 67

  Fly    77 FMLLFAFICVAFLWLMSFNIGTYFSPVLKIISLKLHMNEYLAGVTFLAFGNCSPEIIANLM---P 138
            |::| |.:|           ..|..|.::.:...|.|...:||.||||....:||:..|.:   .
  Fly    68 FVIL-AIVC-----------DDYLVPAMERLCYTLRMTYDVAGATFLAASTSAPELFVNFVGTFV 120

  Fly   139 VRADAPIFTITVGNTLAIILLSGGTVCFLRPFRMNGHSTLRDLLFLLLGVEVLRFVMIKEGAVTL 203
            ...|..:.||...:...|::::|....|.:|.:::.....||..:.|:.:..|.:| :.:..|..
  Fly   121 TNGDIGLGTIVGSSVFNILVIAGVCGIFTQPTKLDWWPVTRDTAWYLIAIASLTYV-LWDSLVMW 184

  Fly   204 GEGIVLFLIYVVYVAINIADLALLRYYIRKLRRELDYLEGLTPPPITEINAKIRKLISWEEQDDI 268
            .|...|.|:|:.||.                  :|.:            :.:|:.|:        
  Fly   185 YEAFALLLLYISYVI------------------QLSF------------DRRIQNLV-------- 211

  Fly   269 GIKDTTKYRRSRDTGNHFSNMTSSGYFVTPIPERRSEHVDYELNRTALHDSENPKNLQLFTEFFQ 333
                                              |.||.:.||    |.:               
  Fly   212 ----------------------------------RHEHAESEL----LDE--------------- 223

  Fly   334 SLNPVDAEAWQLGGWSNRIYLIARCPLVFVLQLFIPVVDYEKIKHGWSKLLNCTQIVTNPFVVIT 398
              :|:..|...|.|:  |.::.|:           |..:|...:..|                  
  Fly   224 --DPMTREEEPLKGF--RDHVCAK-----------PKTEYNFYQWTW------------------ 255

  Fly   399 LVHSGVSSVYKTWHITLDFSISMWSPCLTVPLAIVIFLHSRTDVPPSYHHLFIILTFFSSMVT-- 461
                        |  .:.:...:...| |||.|..|                    ||.||::  
  Fly   256 ------------W--AIKYPAELMLAC-TVPSARSI--------------------FFLSMISAI 285

  Fly   462 LWLAVTE--LEVLSEIVGIVFNLSESFMAVTFEAVSNATPDIIANYQLALQGYGRMAFAAIIGGP 524
            ||:::..  |.....|:|...|:.::.|.:|..|...:.|::.::|.::.:|||.||....||..
  Fly   286 LWISLISYLLTWFLTILGYNLNIPDAIMGLTVLAAGTSVPEVASSYIVSKKGYGSMAICNAIGSN 350

  Fly   525 VFAILVSMSLAF-----IFNHRVREVGANSWVYGDLGDNCYL-----FLVITIVTTMWWSVTFDF 579
            .|.|||.:.|.:     |:..::           |: |:..|     .||:|........:...|
  Fly   351 TFDILVCLGLPWLLKILIYQQKI-----------DI-DSTALTITTAMLVVTAAVLYLGLLARRF 403

  Fly   580 HARRSAGVFLWLVYLQFLLYAVCVE 604
            ...::.|....:.|..||:.|..:|
  Fly   404 VMGKTVGYLSIIFYALFLIIACTLE 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14744NP_001097232.2 Na_Ca_ex 79..221 CDD:279963 35/144 (24%)
Na_Ca_ex 450..601 CDD:279963 39/164 (24%)
CG12061NP_001104467.2 TIGR00367 61..422 CDD:273039 100/544 (18%)
Na_Ca_ex 62..199 CDD:279963 36/149 (24%)
Na_Ca_ex 276..424 CDD:279963 40/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.