DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14744 and Slc24a5

DIOPT Version :9

Sequence 1:NP_001097232.2 Gene:CG14744 / 35858 FlyBaseID:FBgn0033324 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_778199.2 Gene:Slc24a5 / 317750 MGIID:2677271 Length:501 Species:Mus musculus


Alignment Length:561 Identity:127/561 - (22%)
Similarity:209/561 - (37%) Gaps:166/561 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VLFMLLFAFICVAFLWLMSFNIGTYFSPVLKIISLKLHMNEYLAGVTFLAFGNCSPEIIANLMPV 139
            |::.|:..::|:|    :|.....||.|.|:|||..|.:::.:||.||:|.|:.:||::...:.|
Mouse    70 VIYFLIILYMCMA----ISIVCDKYFLPSLEIISDSLGLSQDVAGATFMAAGSSAPELVTAFLGV 130

  Fly   140 ---RADAPIFTITVGNTLAIILLSGGTVCFLRPFRMNGHSTL------RDLLFLLLGVEVLRFVM 195
               :.|..|.|| :|:  ||..|.|  :|.......|..|||      ||.....:.|..: |.:
Mouse   131 FITKGDIGISTI-LGS--AIYNLLG--ICAACGLLSNMVSTLSCWPLFRDCAVYAVSVGAV-FGI 189

  Fly   196 IKEGAVTLGEGIVLFLIYVVYVAINIADLALLRYYIRK-------LRRELDYLEGLTPPPITEIN 253
            |.:..:...||..|.|||.:||.:...|..:.|:.::.       |.|.:            |..
Mouse   190 IFDNRIYWYEGAGLLLIYGLYVLLLCFDTTISRHVMKTCSPCCPCLARAM------------EER 242

  Fly   254 AKIRKLISWEEQDDIGIKDTTKYRRSRDTGNHFSNMTSSGYFVTPIPERRSEHVDYELNRTALHD 318
            .:.:.|:.||::..:.|:     |:||         |.||.|        .|...|.....:||.
Mouse   243 IEQQTLLGWEDESQLFIR-----RQSR---------TDSGIF--------QEDSGYSQLSLSLHG 285

  Fly   319 ----SENPKNLQLFTEFFQSLNPVDAEAWQLGGWSNRIYLIARCPLVFVLQLFIPVVDYEKIKHG 379
                ||:|                                    |.||.:    |..|..:|  .
Mouse   286 LSQVSEDP------------------------------------PSVFSM----PEADLRRI--F 308

  Fly   380 WSKLLNCTQIVTNPFVVITLVHSGVSSVYKTWHITLDFSISMWSPCLTVPLAIVIFLHSRTDVPP 444
            |        :::.|  :|||:                        .||.|           |...
Mouse   309 W--------VLSLP--IITLL------------------------ALTTP-----------DCRR 328

  Fly   445 SYHHLFIILTFFSSMVTLWL-AVTELEV-LSEIVGIVFNLSESFMAVTFEAVSNATPDIIANYQL 507
            .:...:.::|||  |..||: |.|.:.| :..:.|....:.::.|.:|..|...:.||.:.:..:
Mouse   329 KFWKNYFVITFF--MSALWISAFTYILVWMVTVTGETLGIPDTVMGLTLLAAGTSIPDTVTSVLV 391

  Fly   508 ALQGYGRMAFAAIIGGPVFAILV-----SMSLAFIFNHRVREVGANSWVYGDLGDNCYLFLVITI 567
            |.:|.|.||.:.|:|..||.:|.     .:..||.......||.:....|..:..|..:..:...
Mouse   392 ARKGKGDMAISNIVGSNVFDMLCLGLPWFIKTAFTNASAPIEVNSKGLTYITISLNISILFLFLA 456

  Fly   568 VTTMWWSVTFDFHARRSAGVFLWLVYLQFLLYAVCVEWDVV 608
            |....|.:.      |..||...::||.....:|..|..::
Mouse   457 VHFNGWKLD------RKLGVVCLVLYLGLATLSVLYEIGII 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14744NP_001097232.2 Na_Ca_ex 79..221 CDD:279963 48/150 (32%)
Na_Ca_ex 450..601 CDD:279963 38/157 (24%)
Slc24a5NP_778199.2 Na_Ca_ex 72..216 CDD:279963 48/153 (31%)
TIGR00367 77..477 CDD:273039 121/538 (22%)
Na_Ca_ex 334..485 CDD:279963 38/158 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.