DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14744 and Slc24a5

DIOPT Version :9

Sequence 1:NP_001097232.2 Gene:CG14744 / 35858 FlyBaseID:FBgn0033324 Length:620 Species:Drosophila melanogaster
Sequence 2:XP_038960915.1 Gene:Slc24a5 / 311387 RGDID:1310565 Length:503 Species:Rattus norvegicus


Alignment Length:559 Identity:127/559 - (22%)
Similarity:202/559 - (36%) Gaps:162/559 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VLFMLLFAFICVAFLWLMSFNIGTYFSPVLKIISLKLHMNEYLAGVTFLAFGNCSPEIIANLMPV 139
            |::.|:..::.:|    :|.....||.|.|:|||..|.:::.:||.||:|.|:.:||::...:.|
  Rat    72 VIYFLITLYMFMA----VSIVCDKYFLPSLEIISDSLGLSQDVAGATFMAAGSSAPELVTAFLGV 132

  Fly   140 ---RADAPIFTITVGNTLAIILLSGGTVCFLRPFRMNGHSTL------RDLLFLLLGVEVLRFVM 195
               :.|..|.|| :|:  ||..|.|  :|.......|..|||      ||.....:.|..: |.:
  Rat   133 FITKGDIGISTI-LGS--AIYNLLG--ICAACGLLSNMVSTLSCWPLFRDCAVYAVSVGAV-FGI 191

  Fly   196 IKEGAVTLGEGIVLFLIYVVYVAINIADLALLRYYIRKLRRELDYLEGLTPPPITEINAKI---- 256
            |.:..|...||.:|.|||.:||.:...|..:.||..:..|            |.....||.    
  Rat   192 IFDNRVYWYEGALLLLIYGLYVLLLCFDTTISRYVTKTCR------------PCCPCLAKAMEER 244

  Fly   257 ---RKLISWEEQDDIGIKDTTKYRRSRDTGNHFSNMTSSGYFVTPIPERRSEHVDYELNRTALHD 318
               :.|:.||.:..|.|:     |:||         |.||.|        .|...|.....:||.
  Rat   245 SEQQTLLGWENESQIYIR-----RQSR---------TDSGIF--------QEDSGYSQLSLSLHG 287

  Fly   319 ----SENPKNLQLFTEFFQSLNPVDAEAWQLGGWSNRIYLIARCPLVFVLQLFIPVVDYEKIKHG 379
                ||:|.::       .|:...|.         .||:.:...|::.:|.|..|          
  Rat   288 LSQVSEDPPSV-------FSMPEADL---------RRIFWVLSLPVITLLALTTP---------- 326

  Fly   380 WSKLLNCTQIVTNPFVVITLVHSGVSSVYKTWHITLDFSISMWSPCLTVPLAIVIFLHSRTDVPP 444
                 :|.:.:...:.|||.                 |..:.|....|                 
  Rat   327 -----DCRRKLWKNYFVITF-----------------FMSAFWISAFT----------------- 352

  Fly   445 SYHHLFIILTFFSSMVTLWLAVTELEVLSEIVGIVFNLSESFMAVTFEAVSNATPDIIANYQLAL 509
                          .|.:|:..        |.|....:.::.|.:|..|...:.||.:|:..:|.
  Rat   353 --------------YVLVWMVT--------ITGETLGIPDTVMGLTLLAAGTSIPDTVASVLVAR 395

  Fly   510 QGYGRMAFAAIIGGPVFAILV-----SMSLAFIFNHRVREVGANSWVYGDLGDNCYLFLVITIVT 569
            :|.|.||.:.|:|..||.:|.     .:..||.......||.:....|..:..|..:||:...|.
  Rat   396 KGKGDMAISNIVGSNVFDMLCLGLPWFIKTAFTNASAPIEVNSKGLTYITISLNISIFLLFLAVH 460

  Fly   570 TMWWSVTFDFHARRSAGVFLWLVYLQFLLYAVCVEWDVV 608
            ...|.:.      |..||...:.||.....:|..|..::
  Rat   461 FNGWKLD------RKLGVVCLVSYLGLATLSVLYELGII 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14744NP_001097232.2 Na_Ca_ex 79..221 CDD:279963 48/150 (32%)
Na_Ca_ex 450..601 CDD:279963 35/155 (23%)
Slc24a5XP_038960915.1 2A1904 <20..>241 CDD:273344 56/190 (29%)
2A1904 <293..493 CDD:273344 54/292 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.