DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12376 and Slc24a1

DIOPT Version :10

Sequence 1:NP_610405.3 Gene:CG12376 / 35857 FlyBaseID:FBgn0033323 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_064475.1 Gene:Slc24a1 / 56814 RGDID:620080 Length:1181 Species:Rattus norvegicus


Alignment Length:209 Identity:57/209 - (27%)
Similarity:101/209 - (48%) Gaps:24/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DLNCVNEFEQVIFLALFMGLCYEILVLLIHVCNKYYSPALKAVSRFLCMNEHVAGVTLLAFGNSS 126
            ||..|.:..|...:....|:.| :.|.|..||::|:.|||..::..|.::|.|||.|.:|.|.|:
  Rat   410 DLFSVEDRRQGWVVLHIFGMTY-VFVALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSA 473

  Fly   127 ADLFSNLASV---NANVPVFANSLAAALF-VSMVSGGLICYTSP-FKMNAYESVRDILFLIFG-S 185
            .:||::|..|   ::||.: ...:.:|:| :..|.|....::.. ..:..:...||:.|.|.. |
  Rat   474 PELFTSLIGVFISHSNVGI-GTIVGSAVFNILFVIGTCALFSREILNLTWWPLFRDVSFYILDLS 537

  Fly   186 MLLQYFLASSAHVPETSFIVMFLVYIFYI--------LVNVVDVYLIRRALKTTNAQIDALLVGE 242
            ||:.:||.|.....|:  :::.|.|..|:        :...|...|.||.:    |::.||  |:
  Rat   538 MLIVFFLDSLIAWWES--LLLLLAYALYVFTMKWNKQIERWVKEQLSRRPV----AKVMAL--GD 594

  Fly   243 MTPEKRKRLSELER 256
            ::......:.|.|:
  Rat   595 LSKPSDGAIEENEQ 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12376NP_610405.3 PLN03151 33..592 CDD:215604 57/209 (27%)
Slc24a1NP_064475.1 2A1904 1..1181 CDD:273344 57/209 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..232
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..276
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..323
Alpha-1 461..501 14/40 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 598..617 2/11 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 650..983
14 X approximate tandem repeats 730..905
Alpha-2 1061..1092
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.