DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12376 and slc8b1

DIOPT Version :9

Sequence 1:NP_610405.3 Gene:CG12376 / 35857 FlyBaseID:FBgn0033323 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_021333605.1 Gene:slc8b1 / 560601 ZFINID:ZDB-GENE-130530-900 Length:301 Species:Danio rerio


Alignment Length:200 Identity:48/200 - (24%)
Similarity:92/200 - (46%) Gaps:32/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ERCAFVASAKDCNRSTNVLPYMRIMAC-------DLNCVNEFEQVIFLALFMGLCYEILVLLIHV 92
            :||.:|.:..||......:.|..:..|       .|........::||.|.:||          :
Zfish    65 QRCEYVKNTPDCASDEGFIKYPFVTFCLFTPSLLPLAITIYVIWLLFLFLVLGL----------I 119

  Fly    93 CNKYYSPALKAVSRFLCMNEHVAGVTLLAFGNSSADLFSNLASVN----ANVPVFANSLAAALFV 153
            .:.::.|.|.|::..|.:..:|||||.||.||.:.|:||.:|:.:    |.:.:.| ...|.:||
Zfish   120 ASDFFCPNLSAIASTLRLTHNVAGVTFLALGNGAPDVFSAMAAFSHPQTAGLAIGA-LFGAGIFV 183

  Fly   154 SMVSGGLICYTSPFKMNAYESVRDILF---LIFGSMLLQYFLASSAHV---PETSFIVMFLVYIF 212
            :.|..|.:....||.:.:...:||::|   .:|.:..:.|    ..|:   ....::.|::.|:|
Zfish   184 TTVVAGSVALVKPFTVASRPFLRDVIFYMAAVFWTFTVLY----KGHISLGESVGYLGMYIAYVF 244

  Fly   213 YILVN 217
            .::::
Zfish   245 TVILS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12376NP_610405.3 PLN03151 33..592 CDD:215604 48/199 (24%)
Na_Ca_ex 85..219 CDD:279963 35/142 (25%)
Na_Ca_ex 448..595 CDD:279963
slc8b1XP_021333605.1 Na_Ca_ex 66..>246 CDD:332332 48/194 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41602
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257493at33208
OrthoFinder 1 1.000 - - FOG0000933
OrthoInspector 1 1.000 - - otm26516
orthoMCL 1 0.900 - - OOG6_101277
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X612
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.