DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12376 and slc8b1

DIOPT Version :9

Sequence 1:NP_610405.3 Gene:CG12376 / 35857 FlyBaseID:FBgn0033323 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001017082.1 Gene:slc8b1 / 549836 XenbaseID:XB-GENE-957176 Length:238 Species:Xenopus tropicalis


Alignment Length:218 Identity:63/218 - (28%)
Similarity:101/218 - (46%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FDNFWDTVSCYAANTFPFEERCAFVASAKDCNRSTNVLPYMRIMACDLNCVNEFEQVIF-LALF- 78
            |::..:...|..........||.|..:..||:.....:.|:....|      .|...:| ||:| 
 Frog    33 FNSVQNKADCQEVGKLDASLRCNFTRTTPDCSVGDGYINYLDGAFC------SFLPSLFPLAIFL 91

  Fly    79 --MGLCYEILVLLIHVCNKYYSPALKAVSRFLCMNEHVAGVTLLAFGNSSADLFSNLASVNANVP 141
              :.|.|..::|.: ...|::.|.|.|:||.|.::.:|||||.|||||.:.|:||.:|:      
 Frog    92 YTLWLLYLFIILAV-TAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAA------ 149

  Fly   142 VFANSLAAAL----------FVSMVSGGLICYTSPFKMNAYESVRDILFLIFGSMLLQYFLASSA 196
             |::|..|.|          ||:.|..|.|....||...:...:|||:|.| .::.|.:|:....
 Frog   150 -FSDSRTAGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYI-SAIFLTFFILYQG 212

  Fly   197 HVPETSFIVMFLVYIFYILVNVV 219
            .|.....:|..|:|:.|:.|.|:
 Frog   213 FVTLAEALVYLLLYLVYVFVVVI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12376NP_610405.3 PLN03151 33..592 CDD:215604 61/201 (30%)
Na_Ca_ex 85..219 CDD:279963 46/143 (32%)
Na_Ca_ex 448..595 CDD:279963
slc8b1NP_001017082.1 Na_Ca_ex 94..219 CDD:279963 43/133 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8955
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41602
Inparanoid 1 1.050 205 1.000 Inparanoid score I3626
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257493at33208
OrthoFinder 1 1.000 - - FOG0000933
OrthoInspector 1 1.000 - - otm47675
Panther 1 1.100 - - LDO PTHR12266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X612
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.