DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12376 and SLC24A5

DIOPT Version :9

Sequence 1:NP_610405.3 Gene:CG12376 / 35857 FlyBaseID:FBgn0033323 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_995322.1 Gene:SLC24A5 / 283652 HGNCID:20611 Length:500 Species:Homo sapiens


Alignment Length:582 Identity:113/582 - (19%)
Similarity:209/582 - (35%) Gaps:178/582 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CDLNCVNEFEQVIF----------LALFMGLCYEILVLLIHVCNKYYSPALKAVSRFLCMNEHVA 115
            |.::..:||.:..|          :..|:.:.|..:.:.| ||::|:.|:|:.:|..|.:::.||
Human    46 CVISPSSEFPEGFFTRQERRDGGIIIYFLIIVYMFMAISI-VCDEYFLPSLEIISESLGLSQDVA 109

  Fly   116 GVTLLAFGNSSADLFSNLASVNANVPVF--------ANSLAAALF-----------VSMVSGGLI 161
            |.|.:|.|:|:.:|      |.|.:.||        :..|.:|::           :|.....|.
Human   110 GTTFMAAGSSAPEL------VTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNTVSTLS 168

  Fly   162 CYTSPFKMNAYE-SVRDILFLIFGSMLLQYFLASSAHVPETSFIVMFLVYIFYILVNVVDV---- 221
            |:.......||. |...:|.:|:.:.:..|..|           ::.|:|..|:||...|:    
Human   169 CWPLFRDCAAYTISAAAVLGIIYDNQVYWYEGA-----------LLLLIYGLYVLVLCFDIKINQ 222

  Fly   222 YLIRRALKTTNAQIDALLVGEMTPEKRKRLSELERNQAIYTRDMEVEIFERTNSGPNINKIRYTT 286
            |:|::.     :...|.|...|...:::.|...|.....:.|..     .||:||.......|:.
Human   223 YIIKKC-----SPCCACLAKAMERSEQQPLMGWEDEGQPFIRRQ-----SRTDSGIFYEDSGYSQ 277

  Fly   287 LRMGRSTRISLDRKATRMVLHNRALGRNWGLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAV 351
            |.:.               ||        ||.:   ::..|.:.....:.: :||.|.:..:|.:
Human   278 LSIS---------------LH--------GLSQ---VSEDPPSVFNMPEAD-LKRIFWVLSLPII 315

  Fly   352 IICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMYS 416
            .:..:..|    :..|..|.              :...|...:|    ::|              
Human   316 TLLFLTTP----DCRKKFWK--------------NYFVITFFMS----AIW-------------- 344

  Fly   417 LPITVPIAVFMFIQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMG 481
                  |:.|.:|                        :::        ::.:.|..|::.|..||
Human   345 ------ISAFTYI------------------------LVW--------MVTITGETLEIPDTVMG 371

  Fly   482 ATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLF--GLPVSEANQ 544
            .|:.|...|:...||:|.:|..|...||.::.:|...|. ::.......:|..|  |...:|.|.
Human   372 LTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFD-MLCLGIPWFIKTAFINGSAPAEVNS 435

  Fly   545 TG----NYGLN-AFIFLNLGVFSTLLWSTTLGFFARRSVGIFSIVFYCIYLLFAILIHRKVI 601
            .|    ...|| :.|||.|.|...       |:...|.:||..::.|......::|....:|
Human   436 RGLTYITISLNISIIFLFLAVHFN-------GWKLDRKLGIVCLLSYLGLATLSVLYELGII 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12376NP_610405.3 PLN03151 33..592 CDD:215604 111/571 (19%)
Na_Ca_ex 85..219 CDD:279963 37/153 (24%)
Na_Ca_ex 448..595 CDD:279963 35/153 (23%)
SLC24A5NP_995322.1 Na_Ca_ex <20..>224 CDD:332332 44/195 (23%)
Na_Ca_ex <290..490 CDD:332332 50/282 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.