DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12376 and Slc24a4

DIOPT Version :10

Sequence 1:NP_610405.3 Gene:CG12376 / 35857 FlyBaseID:FBgn0033323 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_742164.2 Gene:Slc24a4 / 238384 MGIID:2447362 Length:622 Species:Mus musculus


Alignment Length:100 Identity:25/100 - (25%)
Similarity:39/100 - (39%) Gaps:18/100 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GGSNNGNNHHSSSNGSSS---SNGGRANKPPDIVIKV-----------DTEIPILPQSPSPPPQQ 275
            |...:|:..|..|:.|:|   |......|..|||:..           |.::..|.:.|:..|..
Mouse     2 GAEQSGDADHKHSDFSASVVPSPAKHRAKMDDIVVVAQGTQSLRNIHNDPDVIKLQEIPTFQPLL 66

  Fly   276 RSSLAGGQSQQTASL----LASTLQPSQQHRPLLH 306
            :..|:|..|..|..|    .|..||...:::..||
Mouse    67 KGVLSGQTSPSTVCLEKLDSAQVLQLCVRYQDHLH 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12376NP_610405.3 PLN03151 33..592 CDD:215604 24/99 (24%)
Slc24a4NP_742164.2 2A1904 <80..606 CDD:273344 5/21 (24%)
Alpha-1 139..179
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..408
Alpha-2 495..526
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.