DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and CTDP1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_004706.3 Gene:CTDP1 / 9150 HGNCID:2498 Length:961 Species:Homo sapiens


Alignment Length:262 Identity:61/262 - (23%)
Similarity:112/262 - (42%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSQLPAQSADLDKLAPSGQFAVAVVSNLQRSRSSSDRRGLVLILLSSDLGTYIRRLLARVAEKA 65
            :|.:|.||...:  :||.     ||:..|:........:|     |.::.|..:.:|.::..::.
Human    90 VVRELCAQPGQV--VAPG-----AVLVRLEGCSHPVVMKG-----LCAECGQDLTQLQSKNGKQQ 142

  Fly    66 CTILRTYLGL--SYREVSVSQDMAHRLAVVGRK-----------TLVLDLDETLVHSCYLDPDTH 117
            ..:....:.:  |..|:.||.:.|.:|   ||:           .|::|||:||:|:    .:.|
Human   143 VPLSTATVSMVHSVPELMVSSEQAEQL---GREDQQRLHRNRKLVLMVDLDQTLIHT----TEQH 200

  Fly   118 DNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQV 182
                |.|:....    :.:..:...||:: ....|||..:||:.::|.|:|.::|....:||..:
Human   201 ----CQQMSNKG----IFHFQLGRGEPML-HTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTI 256

  Fly   183 VDHLDAGRGLITRRFY-RQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTF 246
            ...||..:.|.:.|.. |..|............|.....|.|.|||:....:: |..|.|.:|.:
Human   257 AGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWK-FAPNLITVKKY 320

  Fly   247 IY 248
            :|
Human   321 VY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 41/166 (25%)
CTDP1NP_004706.3 Biotinyl_lipoyl_domains 21..111 CDD:299706 8/27 (30%)
FCP1_euk 177..323 CDD:131304 40/160 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..589
BRCT 636..716 CDD:237994
FCP1_C 716..961 CDD:286402
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 730..752
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.