DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8584 and FCP1

DIOPT Version :9

Sequence 1:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_014004.1 Gene:FCP1 / 855320 SGDID:S000004890 Length:732 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:64/275 - (23%)
Similarity:100/275 - (36%) Gaps:79/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILLSSDLGTYIRRLLARVAEKACTILR------TYLGLSY---REVSVSQDMAHRLAVVG---- 94
            ||..:.|:|..:    |...:..|.|.|      .|.||..   :|||........|.|||    
Yeast    91 LISWNVDVGDEV----ATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFDGVPLDVVGDVDL 151

  Fly    95 ----------------------RKTLVLDLDETLVHSCYLDP--------------DTHDNVGCS 123
                                  :..||:|||:|::| |.:||              :|..:|...
Yeast   152 QISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIH-CGVDPTIAEWKNDPNNPNFETLRDVKSF 215

  Fly   124 QLPEH-AQPDYVLNISIDGMEPIVFR-----VFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQV 182
            .|.|. ..|...:|.....:.|...|     |..||.:.||...|:..:::.|||.:...||.|:
Yeast   216 TLDEELVLPLMYMNDDGSMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQI 280

  Fly   183 VDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTP-DMSGVLIIDNSPYAYRDFPDNAIPIKTF 246
            ...:|....|...|...:....|  :.:|.|..:.| |.|.|::||:....:...|:        
Yeast   281 AKIVDPTGELFGDRILSRDENGS--LTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPN-------- 335

  Fly   247 IYDPDDTELLKMLPF 261
                    |:|::|:
Yeast   336 --------LIKVVPY 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 46/188 (24%)
FCP1NP_014004.1 Biotinyl_lipoyl_domains 88..>112 CDD:416260 6/24 (25%)
FCP1 150..623 CDD:227517 46/212 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.